PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 800aa    MW: 89464.4 Da    PI: 9.906
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3512.6e-16243335498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v++   l++  kfa+++ +++ ++  l++  +   sW+vk+  + ++      +GWk Fv +n+Lk gD++vF++++ ++    v++fr
  XP_016490750.1 243 FMQPSYVFSPFSLSIALKFARKYFLENYGNLVLRVPGRGRGSWSVKC--TTRGTNAKVHSGWKAFVLDNKLKCGDVCVFEVIKGTRLFIDVTIFR 335
                     5789*******************88888887888888888*******..66666677899********************987655556677766 PP

2B336.96.3e-12501593598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfr 98 
                     + ps+v+k   l ++  fa ++  ++ ++  l++  + + sW vk+   k++ ++ ++  Wk Fv +n+Lk gD +vF+l++  ++  l v++fr
  XP_016490750.1 501 MQPSYVSKPYSLHISLLFAVKYFRENCGNLVLRVPGSGSGSWPVKYALGKSKPKICFS--WKAFVLDNKLKFGDACVFELIKGgTKPILDVTIFR 593
                     67899999999***********65544544555555666*******988888888888..********************976566667777776 PP

3B354.12.9e-17700790395
                     EE-..-HHHHT....T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   3 kvltpsdvlks....grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     + ++++++ +s     +l++  + a+++   k++  +++l+++s rsW vk+  + +     lt+GWkeFv +n+Lk+gD++vF++++rs+   +
  XP_016490750.1 700 TCFMQPSYVSSasgpMQLSITLSRARKFFAAKHS--DVVLQNSSKRSWAVKC--SLGTVNAKLTSGWKEFVLDNNLKVGDVCVFERVSRSKL--L 788
                     5555444444446668899999999999755444..8***************..55555677***********************7766555..4 PP

                     EE CS
              B3  94 vk 95 
                     + 
  XP_016490750.1 789 FN 790
                     44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-13179IPR015300DNA-binding pseudobarrel domain
CDDcd100176.01E-8177No hitNo description
Gene3DG3DSA:2.40.330.103.3E-13179IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.038179IPR003340B3 DNA binding domain
PROSITE profilePS5086312.478179IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.2E-21232337IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.01E-19233336IPR015300DNA-binding pseudobarrel domain
CDDcd100172.79E-17238335No hitNo description
SMARTSM010195.2E-12239337IPR003340B3 DNA binding domain
PROSITE profilePS5086311.561240337IPR003340B3 DNA binding domain
PfamPF023622.9E-13243335IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-16489594IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.14E-16490593IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-11496595IPR003340B3 DNA binding domain
PROSITE profilePS5086310.644497595IPR003340B3 DNA binding domain
PfamPF023621.7E-9501593IPR003340B3 DNA binding domain
CDDcd100179.87E-15501593No hitNo description
Gene3DG3DSA:2.40.330.104.2E-23691794IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-20694795IPR015300DNA-binding pseudobarrel domain
CDDcd100172.44E-15697794No hitNo description
PROSITE profilePS5086313.084702797IPR003340B3 DNA binding domain
SMARTSM010197.4E-10702792IPR003340B3 DNA binding domain
PfamPF023624.8E-15709789IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MRIPEDFASI YCKNMLNPVY LEVPSGEVWE VEVVHSQGQI CLGIGWQDFS DFYSISRGHF  60
LMFGYNARSH FNVSIFDLSA SEIEYPYSSA HGIHTPIFHC HETRHAPKRD QSESDDSVEI  120
LEGIPRSQKA KAIIPDTIEH SVENLGHCPL GQSSKRKRKE GDTENDVSVD MHIKRMEVEK  180
SQENVASPSF TREGKKSNKG CRMQKQQSES VYGPNKAVMD RKSAVAYQRA KAFKSKNPFM  240
TSFMQPSYVF SPFSLSIALK FARKYFLENY GNLVLRVPGR GRGSWSVKCT TRGTNAKVHS  300
GWKAFVLDNK LKCGDVCVFE VIKGTRLFID VTIFRAAGST LMHKIIGEVP GDSDSKSNVF  360
KTDNCVPCSQ PKVVHTKKLK QRKGGSYEEH GEGTEIEHSV EILGHCPLAH GSKRKRPEGE  420
AEGNVSIDIH TKSINVENTQ EHVASPSITR KTKRSGESCR MHKQQSEVVY AKNKTVDKER  480
SIAYQRAKAF TSENPFVIYF MQPSYVSKPY SLHISLLFAV KYFRENCGNL VLRVPGSGSG  540
SWPVKYALGK SKPKICFSWK AFVLDNKLKF GDACVFELIK GGTKPILDVT IFRAAESKPM  600
HKIDAKLAGV SDSKKKTIKT ENSVPCSQPK IVHSRKLNFE KKQRGDSDCF TSKIKEEPSE  660
AAGKHVQQSK SSCKGSAVAK EMVLAYLRAK AFTSENPFFT CFMQPSYVSS ASGPMQLSIT  720
LSRARKFFAA KHSDVVLQNS SKRSWAVKCS LGTVNAKLTS GWKEFVLDNN LKVGDVCVFE  780
RVSRSKLLFN VIIYTSAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A4e-1420933518141B3 domain-containing transcription factor VRN
4i1k_B4e-1420933518141B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-44HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-44HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490738.10.0PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X1
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-32B3 family protein